PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00004958001
Common NameGSBRNA2T00004958001, LOC106442979
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 251aa    MW: 27900.7 Da    PI: 10.1839
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00004958001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.67.7e-3069122155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          +prl+Wtp+LH+rFv+av+++ G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  GSBRNA2T00004958001  69 RPRLVWTPQLHKRFVDAVAHI-GIKNAVPKTIMQLMSVEGLTRENVASHLQKYRL 122
                          59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.55E-2066126IPR009057Homeodomain-like
PROSITE profilePS512949.29266125IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-3068127IPR009057Homeodomain-like
TIGRFAMsTIGR015577.4E-2470122IPR006447Myb domain, plants
PfamPF002494.4E-772121IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MRDEEEELPS PEELIPLSQS LITPHLAIAF DLRSTYHRKN GSSGHPLPQT TPIQANSSAG  60
DEPARTLKRP RLVWTPQLHK RFVDAVAHIG IKNAVPKTIM QLMSVEGLTR ENVASHLQKY  120
RLYLKRMQSG GGNVGESDRL FASSPVPAHF LHPTGRQSSD HFIPSFVPMA ATLTHQQFLH  180
RQTPAVNFTS QANNNGKVME QSLFLARQSQ HQPVLIRPSS LHLQSRVANY AEDLESGAKT  240
VLTLFPTRQD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-2068127463ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.234173e-34leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00056PBMTransfer from AT5G05090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2410480.0AC241048.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB058I10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013740054.10.0PREDICTED: transcription factor PCL1-like
TrEMBLA0A078ISW10.0A0A078ISW1_BRANA; BnaA03g55120D protein
STRINGBra005837.1-P1e-169(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15492791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.12e-97G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]